PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_34833-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 191aa    MW: 20509.3 Da    PI: 10.7164
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_34833-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.6e-171764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  ++++G  tW+++a+  g++R++k+c++rw +yl
  TRIUR3_34833-P1 17 KGLWSPEEDERLYTRITRHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 64
                     678*******************************************97 PP

2Myb_DNA-binding43.19.5e-1472113346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + ++ E+e ++ + k lG++ W+ Ia +m+ gRt++++k++w++
  TRIUR3_34833-P1  72 PISKREEETIISLQKSLGNR-WSVIAGKMP-GRTDNEIKNYWNS 113
                      56889***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.9621268IPR017930Myb domain
SuperFamilySSF466894.21E-2816111IPR009057Homeodomain-like
SMARTSM007172.9E-121666IPR001005SANT/Myb domain
PfamPF002491.4E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-211871IPR009057Homeodomain-like
CDDcd001679.14E-112064No hitNo description
PROSITE profilePS5129416.07669119IPR017930Myb domain
SMARTSM007172.2E-1269117IPR001005SANT/Myb domain
CDDcd001676.16E-1072112No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2272118IPR009057Homeodomain-like
PfamPF002492.6E-1172113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
ASQADVGGGV EAHKERKGLW SPEEDERLYT RITRHGVSTW SSVAQLAGLR RSGKSCRLRW  60
MNYLRPDLKK EPISKREEET IISLQKSLGN RWSVIAGKMP GRTDNEIKNY WNSRIRKRQT  120
LSTGGGKGDS GLAKQGDLPA ADDKASVLAG PRGKEPVSSM ASGATVPPVP ARFPLFACQL  180
LGGGGGAAAI A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251711827127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-126HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968332.16e-75PREDICTED: transcription factor MYB82-like
TrEMBLT1NVE71e-137T1NVE7_TRIUA; Uncharacterized protein
STRINGMLOC_19052.11e-115(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-47myb domain protein 86